PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G08590.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 138aa    MW: 15763.1 Da    PI: 9.2641
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G08590.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.13.5e-261059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rie+   rqvtfskRr g++KKAeEL vLCda+va+++fsstgkl  ++s
  OMERI06G08590.4 10 RIESAAARQVTFSKRRRGLFKKAEELAVLCDADVALVVFSSTGKLSQFAS 59
                     8*********************************************9986 PP

2K-box41.94.4e-15861353584
            K-box  35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                        ++ Ge+Le Ls++eLqq+e++Le +l+++  +K++ ++++i+elq+k 
  OMERI06G08590.4  86 DLNMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKV 135
                      369*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.104161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-24323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.14E-29374IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
CDDcd002651.27E-311375No hitNo description
PRINTSPR004043.0E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.9159138IPR002487Transcription factor, K-box
PfamPF014865.9E-1288135IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MARERREIRR IESAAARQVT FSKRRRGLFK KAEELAVLCD ADVALVVFSS TGKLSQFASS  60
NMNEIIDKYT THSKNLGKTD KQPSIDLNMR GEELEGLSVE ELQQMEKNLE AGLQRVLCTK  120
DQQFMQEISE LQRKVALK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D7e-20272171Myocyte-specific enhancer factor 2A
3mu6_C7e-20272171Myocyte-specific enhancer factor 2A
3mu6_B7e-20272171Myocyte-specific enhancer factor 2A
3mu6_A7e-20272171Myocyte-specific enhancer factor 2A
1tqe_S9e-20173173Myocyte-specific enhancer factor 2B
1tqe_R9e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q9e-20173173Myocyte-specific enhancer factor 2B
1tqe_P9e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118591e-141AK111859.1 Oryza sativa Japonica Group cDNA clone:J033024G19, full insert sequence.
GenBankAY3452231e-141AY345223.2 Oryza sativa (japonica cultivar-group) transcription factor MADS55 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641679.13e-79PREDICTED: MADS-box transcription factor 55 isoform X2
SwissprotQ69TG51e-77MAD55_ORYSJ; MADS-box transcription factor 55
TrEMBLA0A0E0DYX17e-97A0A0E0DYX1_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g11330.18e-79(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.15e-26MIKC_MADS family protein